DPCstruct | MC5378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 186 |
|---|---|
| Mean domain length (aa) | 188 ± 37 aa |
| Standard deviation of domain lengths | 36.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF04366- CL0062- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6R6R7 | 11-147 | STQSKVDATYSRGINVSGSPSAFSFNLQGGISIDTKGNVAIQGTFSGGVTGGSPGASITMYQTVTNASNIKNLEGSGYQIGGSVGVP… |
| A0A1E3HCD6 | 31-218 | VQSFTLPGESEKAAKILRGFLADPLHPATALNSIPKAVLQRAKGLAVFTIIKAGFVFSGKAGSGIVVAKLPDGSWSAPSCIATAGVG… |
| A0A4Y7U0Q9 | 686-901 | None |
| A0A2G2H391 | 8-155 | None |
| A0A8B3E411 | 67-227 | None |
| A0A2N6F684 | 6-172 | None |
| A0A146HNN8 | 311-531 | None |
| A0A1Z8N753 | 81-287 | None |
| A0A066VX75 | 53-291 | None |
| A9ULJ3 | 5-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.