DPCstruct | MC53776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 182 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0G521 | 7-184 | DGDIVLFEYSEEHPLLLPNVGMASKVINYYKKKGNEGRPKFKHGICVVFGKNDTTKHLFLGNLREGTMLQSLSSKLLRVPIYRHRPF… |
| A0A0S7FPR1 | 38-248 | GDMFFMRTPQDLTGKDGDLILAEYSEEYPPLIMQVGMASKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENN… |
| A0A287XVZ7 | 446-628 | None |
| A0A452XC80 | 2-196 | None |
| A0A452XC55 | 1-181 | None |
| A0A061RW54 | 139-329 | None |
| A0A2I0XC58 | 146-330 | None |
| A0A7R9JHT1 | 395-572 | None |
| Q54DH8 | 967-1135 | None |
| A0A060X326 | 713-890 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.