DPCstruct | MC53775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 438 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RJC0 | 35-489 | YCNWEDKIIWDSQAMPQIPSPTVMQLDPNDENIILGIPEDKYPEDKNSSTSTTPKKETKKSKLLLGKNNKNDDDEEQDDNKEESSNM… |
| A0A1B8EB52 | 6-419 | LKRGPAELGVADQSSDSPYSGCRDLCCLVAPVTDVGPKCYVDEHETHRTTLTQGLGKASISDAIEPFVLHSKTYLLVDVHQPNQTDR… |
| A0A813UCJ3 | 1-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.