DPCstruct | MC53773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.82 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0105- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5WXR6 | 1-119 | MLGEEKEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLFTSPNALSCLSGVILFEETLYQKTSDGKPFV… |
| X7ZW44 | 6-114 | EIAADLMAPGKGILAADESIATMSARLRDAGVEPSAERRRDYRELLASTPQLAQSISGIIFCDETLRQTFSDGTPFAQAVAARGILP… |
| A0A835XTZ7 | 70-184 | None |
| A0A4V6RY19 | 137-245 | None |
| A0A4S4ETD6 | 138-243 | None |
| A0A556TIE7 | 1-127 | None |
| A0A674GW18 | 8-127 | None |
| A0A7J7MC76 | 6-120 | None |
| A0A857MNT0 | 342-449 | None |
| A0A812VMD0 | 304-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.