DPCstruct | MC53772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 345 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 26.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 96.23 |
| Assigned Pfam label(s) | PF21691- CL0016- CL0219- PF01657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5WX69 | 14-131 | TTKAQQPAYRHHECPNTTTTSYQANRNTLLSSLSSNSIHANHGFFNTTVGTSRKTVYGLFLCRGDYFITFCRSCVALAADDIARCCP… |
| A0A2I0BB74 | 18-128 | LPAPDTGFVEALCNVASFTAGDPFTESLSYVLADLVTVASARAGHDYYNISPYPNAFAYGHASCSGNLTAGDCADCLHAAVRAVSSA… |
| M4DB06 | 87-199 | None |
| A0A6V7PZV4 | 341-457 | None |
| A0A0D3DL22 | 87-204 | None |
| A0A3P6C0E2 | 6-94 | None |
| A0A396H4Q9 | 97-243 | None |
| A0A2G2WTB5 | 13-109 | None |
| A0A2G2WMX4 | 27-141 | None |
| A0A3Q0FGE1 | 16-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.