DPCstruct | MC53765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 864 |
|---|---|
| Mean domain length (aa) | 135 ± 27 aa |
| Standard deviation of domain lengths | 26.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 96.47 |
| Assigned Pfam label(s) | PF18187- PF18189- CL0010- CL0014- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5XVC8 | 3-119 | DGDTILLSDGRRVRLVQVDAPELGRECHGDASAAALERLAPPGTELRLERDPRLDDVDRHRRHLRYAYADGSNLNVEVVRLGAAAPY… |
| A0A7Y1Y2G9 | 14-145 | LSNCKPSDPDVVTVKKVVDGDTFITTQNETIRLIGIDAPEKQRYAEEAELFAAESTYFLDSLISGQRVKLMFDVETYDVYDRTLAYV… |
| A0A1G1AGA3 | 25-170 | None |
| A0A7S4E782 | 6-121 | None |
| A0A7S8CE47 | 94-240 | None |
| A0A2Z5IPF0 | 111-289 | None |
| A0A7C6Y1Y8 | 162-298 | None |
| A0A523RF69 | 308-454 | None |
| A0A7W0MZV4 | 15-155 | None |
| A0A2E8KMJ2 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.