DPCstruct | MC53764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 203 ± 39 aa |
| Standard deviation of domain lengths | 38.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0Z568 | 38-164 | QLRCGIISKAGGSFTIDHPVYPYNKILNHYFIEGPEMRYIYDGEVILDASGRATVHLPDYFSALNRKPRIQVTGVGTSDVYVAEDIK… |
| A0A7Y1UDW7 | 20-213 | PVTEYESEQLRSTTFYDGTNRVVSEKNEDVSVPSIPPTEIRHIFDPALPFNGNRMELIAGEVFVNGQFTAPLKAFTIDHPLDPYNKK… |
| T2RFS7 | 166-331 | None |
| A0A7U6GL88 | 394-625 | None |
| A0A2V7WCJ4 | 364-579 | None |
| A0A2V7WKY6 | 14-205 | None |
| A0A821TWU0 | 1-208 | None |
| A0A1G2VJL3 | 997-1215 | None |
| A0A1F5J8Q8 | 485-735 | None |
| A0A6L7GLV7 | 154-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.