DPCstruct | MC53763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 799 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 84.33 |
| Assigned Pfam label(s) | CL0123- CL0020- CL0165- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4DKZ3 | 2-107 | EFCVLGPVEVHDSRGNPVDVGGPRQRTVLARLLVAQGAVVSTRTLIEDVYGDAPPVSALATVQSYVSHLRRAIEPDRPARGRPRVLV… |
| A0A7Y1UC94 | 6-96 | EYSFDKRNTELIKGKERIELSAKEADLLLLLYNSANTTVERETILIRVWGNDGDYVGRIMDVFISKLRKKLEADTSVKIVNIRGIGY… |
| A0A1C5UI64 | 278-410 | None |
| A0A6N6KWC4 | 4-117 | None |
| A0A3D0L1M0 | 74-197 | None |
| A0A349XNN4 | 3-87 | None |
| A0A258VH63 | 126-234 | None |
| A0A1F8L0W2 | 1-75 | None |
| I0QLD6 | 3-114 | None |
| A0A6N6KVW3 | 3-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.