DPCstruct | MC53761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 226 ± 50 aa |
| Standard deviation of domain lengths | 49.92 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5SQR2 | 6-221 | KANKELLEIKDKIQEIDIPNSYAIAVEEIGSLMEANKLTIGPRGNHFPILFKNNVIANPQFFGSRERVIQLVREIENIQPRIFYKSY… |
| A0A3A0CIE6 | 405-545 | SVDPDSLLQALGEIEEFDPNLFNNAGVKRFGKPTLLLAPGIGDGVFDSDRNRFVIPQYTLKTPLESVANAAVLYRLDTDAAYNDRRL… |
| A0A847CDG1 | 5-209 | None |
| A0A098QYR4 | 682-989 | None |
| A0A3R6P9K7 | 226-537 | None |
| A0A7Y5BKW0 | 398-704 | None |
| A0A1V5JH68 | 75-274 | None |
| A0A1E3G2K7 | 199-408 | None |
| K2B659 | 118-316 | None |
| A0A7X8J060 | 144-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.