DPCstruct | MC53760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 228 ± 46 aa |
| Standard deviation of domain lengths | 46.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VRI9 | 28-302 | AAATKAAATGDMRFIKMVELDDEVSKLTAMESAHRDTQSHARRRVGTLDREIPNKQAQIDALTGLGKTIERWDTGGRQFAILDGRGE… |
| A0A0N0MGN6 | 23-239 | ARLERLAAAHYDDQFAVKRAIDRAEREIAGAERQIPLIEADIASRQPTKGDAFVLRRDKGDVSEREKAGSWLLSQVRLAAKNGEAGI… |
| A0A379GAM7 | 2-201 | None |
| A0A7Y4GX18 | 123-282 | None |
| A0A1V3WDW3 | 1-226 | None |
| X7VDQ7 | 191-464 | None |
| A0A842GG77 | 24-252 | None |
| A0A7U9R630 | 2-158 | None |
| A0A426UAI0 | 222-499 | None |
| E6LRP3 | 411-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.