DPCstruct | MC5376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3ZN98 | 1-76 | MKPSLLRCLVFLCVLLLPPALGGTKNKYSPGELLLEECWGQPKANDCTKKCSRTFKCVYRNHTCCWTYCGNICAEN |
| A0A455BYF5 | 1-77 | MKCWTPLLMMFLCMVLLSVLGGMKEKHNRRGELLLQECWGQPTVQECAKQCSRTFRCVEINHTCCWTYCGNICWENT |
| A0A811Y122 | 23-101 | None |
| A0A7E6CEJ3 | 8-88 | None |
| A0A3Q7W140 | 48-132 | None |
| A0A1U7SPI7 | 5-89 | None |
| A0A091DZ45 | 9-108 | None |
| A0A2Y9H0B2 | 25-108 | None |
| A0A6P3GPG7 | 1-79 | None |
| A0A7J8DM83 | 110-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.