DPCstruct | MC53759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 161 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5XNN7 | 264-415 | APLPPRGAGASSVLPSLPQSGQSTALPAPAPRVTTTPPPGDPNDKAQELARQQQDILMLRQQMDQRLKDLQDAERKMKDMIREAKDL… |
| F4A1M1 | 43-183 | IPFIGPVINGPELEAKADIEERTTALNKKDADLKAKETSLANKEAELEKREKAVDDKENQLAQKEQELVVKEAELNSKQMAIADMAK… |
| A0A6N6T152 | 61-233 | None |
| A0A7C6LA11 | 42-189 | None |
| A0A1U9LIR3 | 13-132 | None |
| A0A7Y7D1Z5 | 87-256 | None |
| A0A7V0IAI7 | 8-140 | None |
| A0A2A4ZPB0 | 40-187 | None |
| A0A7H4K8S8 | 8-156 | None |
| A0A0S4N4E8 | 40-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.