DPCstruct | MC53757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 385 |
|---|---|
| Mean domain length (aa) | 114 ± 25 aa |
| Standard deviation of domain lengths | 24.68 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.07 |
| Pfam Score | 93.32 |
| Assigned Pfam label(s) | CL0276- CL0052- PF09747- PF01784- PF08572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821KYG7 | 10-115 | SKETSGSLISCDFEIFGTVQGVFFRKYTQKQATKLNLVGWVKNTSSGTVKGHMEGRKDDINAMKNWLRTTGSPRSKITKADFSNEKP… |
| A0A7C0ZUC8 | 2-82 | YGIVQGVFFRSSMRQKAYELGVTGWVMNELDGSVSAVVEGPREAVEENIRWAHRGPPGAVVERVDVEWEEYRGEFKDFRIR |
| A0A812NLV7 | 261-355 | None |
| A0A2E4HG59 | 342-457 | None |
| A0A177WSW8 | 19-110 | None |
| A0A177WMZ7 | 80-252 | None |
| K3WW67 | 2-136 | None |
| A0A7R9A372 | 293-394 | None |
| A0A7W0PJH6 | 2-77 | None |
| A0A6G0XS12 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.