DPCstruct | MC53755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 295 ± 51 aa |
| Standard deviation of domain lengths | 51.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821KFN0 | 39-332 | PQQSQHSAQATNMFITRILDECGLEIKMADEENMNNNDELHLELKVDQGLLAKHLSQRLRSSSNTNCNTTTTTTALPPISLKQFETE… |
| A0A3P7KVN5 | 7-219 | REELLNAFEVALQQRSNLITYLEPSHSTCGIQESMFRILILCRSSQAKAFDLLLNQLESLQKEGQSSVSLSHLCIAQIRFINRIYDS… |
| A0A2U1J5Y6 | 3-247 | None |
| T1HKQ1 | 416-750 | None |
| A0A5K4EQ66 | 53-398 | None |
| A0A183LZU9 | 53-398 | None |
| A0A0K0E3Z8 | 94-339 | None |
| A0A819WS63 | 50-379 | None |
| A0A7J7QSA0 | 14-289 | None |
| A0A1I8M2U3 | 89-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.