DPCstruct | MC5375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3FT59 | 43-106 | GCVEYVLQVKKGSLGETSPMLNDISAVGRWQKVSTGMLKMYQGEVLSKLPIVQHLGFGSLFRWE |
| A0A455BX12 | 8-79 | LSSLWTLFFQMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPIHPAA |
| A0A654GHL3 | 146-219 | None |
| B7ZBQ0 | 1-61 | None |
| A0A167NWP2 | 2-76 | None |
| Q2GSY3 | 433-499 | None |
| A0A1E4SWW5 | 94-172 | None |
| A0A0P4WFA1 | 55-126 | None |
| A0A409W7D5 | 1-82 | None |
| A0A1I7WQX8 | 113-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.