DPCstruct | MC53743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 246 ± 29 aa |
| Standard deviation of domain lengths | 29.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519B9Q6 | 43-303 | NFMDEVKNNSVHVFTSDFAKIVFKELDTIKDFADYLQEKENLINNKQYMIIQGGEEELLAYYLANERTFQGIEKSDFVHFTGGSWES… |
| A0A0S4TPH0 | 161-432 | FVHVFNRTALDTLFECFDTTADLVKYLTEKEALFTQKHVQLTGEEDLIGVYMQGRRPDGGAPLSALVEASEGGVCTVRGGVWSSLQS… |
| A0A2N4WQI2 | 260-484 | None |
| A0A523URM7 | 74-320 | None |
| A0A4R2N573 | 7-237 | None |
| M6VEN0 | 53-278 | None |
| A0A3Q9D7A0 | 6-242 | None |
| A0A034T2F0 | 2-254 | None |
| A0A5E4L1H1 | 2-229 | None |
| A0A090LWU5 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.