DPCstruct | MC53742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 175 ± 35 aa |
| Standard deviation of domain lengths | 34.83 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833RSL1 | 1-135 | MSPSVLVVDVVPWLIASLSPNIRRINPSLQTKEEKLMIQRLIQLMASLGLSFRHKYRPDGSEDYALEPALNELVEFRSREGGTPYQY… |
| A0A7J8EX90 | 352-511 | IAFPSSQQEAQNRTSRVQNLIQTLVSGITPATRSQTSPQALVLDTLCLLLDILVPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTY… |
| A0A183HGH6 | 65-229 | None |
| A0A0B1PPI8 | 97-261 | None |
| A0A183TQ44 | 48-249 | None |
| A0A1I8I702 | 18-198 | None |
| A0A286XE30 | 1-124 | None |
| A0A7S4QRU0 | 44-317 | None |
| A0A7R9B3J0 | 1-116 | None |
| J4HV49 | 492-678 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.