DPCstruct | MC5374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 630 ± 97 aa |
| Standard deviation of domain lengths | 97.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413YJK4 | 40-730 | TVAFANYVKETIYSKSNNIVLLTIIESIGMHFENELPGYALDLATSIELVHWDTTRYMLYKKNPTKELLERQILKTMGIPELKDRYE… |
| A0A841JMV8 | 25-575 | VYWRKALFDMDARKWDWKPVEIPGYENYVQIVPDYDAEVIAAVNSYKPKELPNIGLVWASNVFEGKPVDDRTYDTWKKGFEQLSKPS… |
| A7BRD5 | 1-426 | None |
| A0A2N5X6E0 | 287-1040 | None |
| A0A4U1I958 | 6-664 | None |
| A0A6L6H8N6 | 326-1062 | None |
| A0A0N6ZTK4 | 479-1254 | None |
| A0A2D0A5Z7 | 18-633 | None |
| A0A3M3TT45 | 174-782 | None |
| A0A1L6JD65 | 57-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.