DPCstruct | MC53736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 221 ± 30 aa |
| Standard deviation of domain lengths | 29.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8F894 | 3-228 | ELKRLRKIEEFVLERLKAYGLNTVLQKFDIISEDRMLALIARRLPNNFSFWQTGRDYERFRTRFEHGFGHGILEVVFNLDPSRAFIL… |
| A0A1G2PXX4 | 8-201 | LRDFGERIEDAARGLGLDPYPVRFEIISPREMAEEEALLAMPTRYSHWSFGKAADLSETARGFFGFGAAEIVANANPSRAVLLDDNP… |
| A0A2D6A058 | 54-306 | None |
| A0A1G1ZIT9 | 1-219 | None |
| A0A2R6M0H7 | 12-293 | None |
| A0A2U3D9Z2 | 1-234 | None |
| A0A3S4DPE6 | 26-233 | None |
| A0A7C5N7P2 | 13-263 | None |
| A0A162KTV0 | 3-186 | None |
| A0A535QG73 | 5-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.