DPCstruct | MC53727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 184 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08653 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0S2K4 | 1-175 | MAPEDTNPQSSHRRTRSTSRSRPTTPLRPSSRSSFRSSARGSVYGDNAAFPLNAFEPAFAELADAVADLEANMMHFQLMHESLARFS… |
| A0A074WVT8 | 1-156 | MASTTPTSAPPSRARSASRSRNNLPSRPTTPLRPHSRTSLRASITTPTASNQFSDQAVPLEALEPAFGELADGMADLEANMMHLQLL… |
| A0A2S4PJT9 | 3-200 | None |
| A0A0E9NHT0 | 4-190 | None |
| A0A3M7DPX5 | 41-197 | None |
| A0A2A9PS23 | 4-169 | None |
| F9FCG1 | 97-299 | None |
| A0A7C8I508 | 2-159 | None |
| A0A6J3MBI9 | 1-231 | None |
| A0A5M9MRP2 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.