DPCstruct | MC53724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4DD23 | 1-182 | MSGIVTPFIGKGIISSACTNKESPIKYDHVIIDKEHDSVSRETSVHEHGVYSYNGLSIESAEIIPGTPMGNYHNKQMYPEGLNVIEI… |
| A0A380Q8N7 | 179-371 | SGNINVLKGRGVFSSRRLREIYLRFDAANADELRPGDVYVKKTKFDSMGYDSHFYHEGIGLNGAPTLNTYTGEYVADSSSQGATYWL… |
| A0A5Y0RXY2 | 149-328 | None |
| A0A1E4VHY3 | 23-185 | None |
| A0A022PDV9 | 1-156 | None |
| A0A1S6LRH8 | 1-181 | None |
| A0A2T5NLI5 | 78-252 | None |
| A0A0N9JNY6 | 734-926 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.