DPCstruct | MC53723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9EMS1 | 2-101 | TSLTADGVLNARFQPTRFREGYDQEEVDDFLDTITSILRSHESGERIDASAAVNLCRNARFQPTKFREGYDQHQVDDFLAQLEQGFL… |
| A0A6G7XC59 | 5-89 | TQERTDLANKVINSRFATTKFKAGYDLNDVDDFLDTVARQLRDEPRAEVIAKTIKNAAFRQTKWRDGYNSEQVDRFLDELVKTLR |
| A0A239QUM6 | 9-105 | None |
| A0A4R3L1A1 | 51-148 | None |
| A0A1C5GSQ5 | 980-1063 | None |
| A0A1G9ZJY5 | 2-87 | None |
| A0A2A3AHR4 | 61-144 | None |
| A0A1T4N404 | 93-195 | None |
| A0A545AKG0 | 1-75 | None |
| A0A3A3Z5N5 | 99-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.