DPCstruct | MC5372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 329 ± 29 aa |
| Standard deviation of domain lengths | 28.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812GM72 | 195-527 | NSLGVDAFAPRLQFASESFGPLRRRPVRVREDPELHARVPEMTRASVPGVERWKGERGQKRVLDMLSDCYMQGLWMLGPPSAPANKE… |
| A0A328REN1 | 111-433 | IPEIKNSYDLYFITETPEIYLNQFIDRHSTYGVESGARPQNIIGRLCAILKDPNRFFAQAQITNSVLVNETFSILNVILLTLAQKEP… |
| A0A7S0DR25 | 87-449 | None |
| A0A7S2EJ30 | 314-651 | None |
| A0A7S0UHN7 | 37-367 | None |
| A0A7S2RLC1 | 33-416 | None |
| A0A812MAA9 | 215-570 | None |
| A0A812M5L2 | 168-497 | None |
| A0A813H3D6 | 252-574 | None |
| A0A7S4QC36 | 44-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.