DPCstruct | MC5371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 260 ± 29 aa |
| Standard deviation of domain lengths | 29.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 63.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6L9M4 | 173-427 | GTGTISATGGGGFAGGGGGRVSINVFSRHDNTNFFIHGGISLGCSDNAGAAGTYYDAVPRSLTICNYNFSTQTDTLLLEFPKVPLWT… |
| A0A287F010 | 283-530 | GGGKISACGGNGLSGGGGGRVSIDVFSRHDDTHFFVHGGRSSGCPGNAGAAGTLYEEVPKSITVSNNNLSTQTDTVFLDPPYEPLWT… |
| A0A446IQS4 | 5-287 | None |
| A0A453E6Z2 | 1-213 | None |
| A0A453E6Z4 | 207-488 | None |
| A0A438DZ02 | 29-216 | None |
| A0A1D6LZX3 | 288-570 | None |
| A0A6P6SHP1 | 7-223 | None |
| A0A453A9X6 | 1-267 | None |
| A0A453AA23 | 3-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.