DPCstruct | MC5370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 379 ± 70 aa |
| Standard deviation of domain lengths | 70.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 60.71 |
| Assigned Pfam label(s) | PF03849- PF13625- PF18307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7BUF6 | 67-404 | KPGTAIGWLLDNNILIPMDSHTVALPREFGIKLRGGKVHKELSIKAPDLTGKKLSQKQIDLAAIANISTVMRWCEELLHNLSDEPPT… |
| A0A4D6L744 | 126-525 | MPTMKLDKLYENGFICEAILRSLPPLAKKYVIQMLQIDVPVAAKLLEEWVLPDGFSKHRVAIDRLVQLRVFLEAVDRKNEKTYKVNP… |
| A0A6J6QER5 | 2-250 | None |
| A0A453DGV0 | 53-311 | None |
| A0A7Y4ZHD4 | 97-485 | None |
| L0DRK1 | 19-382 | None |
| A0A847A3H0 | 29-386 | None |
| A0A0V0Q9G1 | 14-285 | None |
| A0A348XMB6 | 337-780 | None |
| A0A523DNI3 | 124-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.