DPCstruct | MC537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 533 ± 62 aa |
| Standard deviation of domain lengths | 62.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.30 |
| Pfam Score | 81.75 |
| Assigned Pfam label(s) | CL0020- CL0202- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800MA05 | 1-444 | DGNDLTDSVVITAPLRDERVSPSGSFKTWRRSVRPTKAEIRPLDPVRDRLDDEEQIHEMIITYNFDQAKPARVTPVLTVDYNDGSDY… |
| A0A2E8Y615 | 1-584 | MVFRTGEMDGTRRIVMHTVQEVPGQSFSESGTRQYITVHGQGTQVQSFSVTGGRTIELAIAQYWSSLGQTEVQVDITFHGINPDSRS… |
| S9XMR8 | 415-929 | None |
| A0A2G2X6T0 | 588-1170 | None |
| A0A1B0BU07 | 1-577 | None |
| A0A7R9PW68 | 433-995 | None |
| A0A5C5XSK2 | 531-978 | None |
| A0A7R8W8K2 | 298-900 | None |
| A0A1Y3AN36 | 294-693 | None |
| A0A7R9LQZ9 | 1-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.