DPCstruct | MC53691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2TXK6 | 3-64 | LVEQIEALLPQTQCGRCDYAACNPYAQALANGEAQVNQCAPGGTPTMQALASLLDRPEVPLS |
| A0A3C1TTI6 | 35-97 | GNDLVDTINAELPQTQCAQCGYPGCRPYAQAISEGAAINLCPPGGSKTAEQLASLMGINFENT |
| A0A3A4WHV6 | 21-85 | None |
| A0A2H0I6M7 | 5-66 | None |
| A0A7C6WF02 | 35-91 | None |
| R7FAH6 | 30-95 | None |
| A0A660RAV0 | 30-89 | None |
| A0A7X7VY40 | 126-191 | None |
| A0A849WC47 | 69-134 | None |
| A0A0S2ZRB0 | 31-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.