DPCstruct | MC5369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6L5D9 | 1-100 | MMHISAERSDEMGNKKVVTRVVYPFAMVKPGGREGDVTLNDINERILMPPTRPVRHPVGDFACRPCVSAEGPGLSGKAVVALTRIHT… |
| A0A445KNH5 | 138-235 | TVAPTENDDMRNKKVVTRVVYPFAMVKPGGREGDVTLNDINERILMPPTRPVRHPVGDFACRPCVSAEGPGLSGKAVVALTRIHTQG… |
| A0A816MNX0 | 279-386 | None |
| A0A444C9E4 | 2-116 | None |
| A0A5D3BG61 | 93-201 | None |
| A0A4S4D9R9 | 161-266 | None |
| A9T1Q8 | 376-490 | None |
| A0A453KYD2 | 268-366 | None |
| A0A1E5VNA2 | 219-318 | None |
| A0A835KHR9 | 272-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.