DPCstruct | MC53687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 52 ± 1 aa |
| Standard deviation of domain lengths | 0.54 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 65.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1MMT6 | 200-251 | TLILHFNMNAGSCPAVQFRVNYKNGGIFYRSARDGYGFEADWSEFYTTTRKP |
| A0A1S9J625 | 94-145 | VLILHFNINAGSCPAVQFRVNYKNGGISYRSARDGYGFELGWSDFYTTTRKP |
| A0A376TKF3 | 259-310 | None |
| A0A377BDT1 | 117-167 | None |
| A0A8B4KWY1 | 37-88 | None |
| A0A8B3TTA0 | 394-445 | None |
| A0A4D1UPV2 | 2-51 | None |
| A0A6L9CAE5 | 34-85 | None |
| A0A656C4U9 | 655-706 | None |
| A0A4U7KHU2 | 137-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.