DPCstruct | MC53682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 193 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259D372 | 1-128 | MAATKSLGEKIKVTAGLGWGRFGSYESIGSPFGDRPEAGTVGRPNVDQWFKGDAAVFGGVEVKVTDTLTVKGEYSSDAYTLEDDERG… |
| A0A377DZ99 | 58-256 | DKAFDLKLRLWEESYWLPQVAVGARDIGGTGLFDAEYLVASKAWGPFDFTLGLGWGYLGTSGNVKNPLCSASDKYCYRDNSYKQAGS… |
| A0A376YIC8 | 20-222 | None |
| A0A432ZKC4 | 424-610 | None |
| A0A447PX65 | 350-552 | None |
| A0A6N3UB84 | 107-306 | None |
| A0A5A7N6A2 | 124-330 | None |
| A0A259N7E0 | 1-193 | None |
| A0A1I6GQZ4 | 96-276 | None |
| A0A522EX48 | 339-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.