DPCstruct | MC5368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 650 ± 109 aa |
| Standard deviation of domain lengths | 109.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7RJN9 | 15-674 | LVVFMAMLAYTANAKCSYEAMFSIGSDFRHGANFATSASTVLQPQTSLFVNGVSPFYLQVQVNQMRQFKSKVEEYNTQSKGQTNLPQ… |
| A0A7J6H8A0 | 7-572 | GANFASAASGYDDSTANLYLAISLSKQYYGEYQSRVVGMIGQAKASSIFSNALYIISVGTSDLIQNYYISPILQATYPNIHQYFNTL… |
| A0A2U1M1W1 | 1-733 | None |
| A0A6P6A5R8 | 25-566 | None |
| A0A7J6XF64 | 343-1079 | None |
| A0A1D6MFV1 | 948-1412 | None |
| A0A5A7PGR0 | 409-1041 | None |
| A0A2P6S3M3 | 14-572 | None |
| A0A835JJS5 | 1-691 | None |
| A0A5J5AIX0 | 1-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.