DPCstruct | MC53678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6I7Q3 | 368-430 | LGIGTSSALGGNSIVLGDNDTGFKQNGDGNLDVYANNVHVMRFVSGSIQSNKTINITGRVNPS |
| A0A377AIT6 | 4-76 | LALGTDNALGGNSITLGDNDTGIKQGGDGVLLFYLNGQLAFGLQPASADFYKRVAYTHQGIVPEGSGAFADQL |
| A0A613XUG5 | 265-347 | None |
| A0A377A3Q7 | 3-69 | None |
| A0A7U7QNC7 | 1-71 | None |
| A0A631CC41 | 227-303 | None |
| B3Y135 | 82-136 | None |
| A0A5Y1W966 | 90-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.