DPCstruct | MC53674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3U5M6 | 31-112 | FYESLNLFTKKYTLCIEPDTGIIRSMAEDVSSLYPAGFTVVDVDELPDGVDISGDWLFEGEKIVPRIPTQGERVAKAKFKKA |
| A0A377A0A8 | 1-98 | MKNFQPDTIKIVYDANNIIVAITKDASTLNPEGFSVVEVPDITANRRADDSGKWMFKDGAVVKRIYTADEQQQQAESQKAVLLSEAE… |
| A0A2S8QRR8 | 9-81 | None |
| A0A5I0KCN9 | 12-94 | None |
| F3WJW9 | 1-66 | None |
| A0A7Z7WBD2 | 649-732 | None |
| A0A509C441 | 35-119 | None |
| A0A3S4IX64 | 10-96 | None |
| A0A376ZHV9 | 1-97 | None |
| A0A377BDC4 | 35-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.