DPCstruct | MC53671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 202 ± 37 aa |
| Standard deviation of domain lengths | 37.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O68653 | 93-285 | VEKNLHFVWIGGEVSDIVLEYIKQWADINAEYNIKLWYDSEAFLVNTLKKAIVESSTTEALQLLEEEIQNPQFDNMKFYKKRMEFIY… |
| A0A376ZW44 | 1-221 | MEIDKKIHVIWIAGAPPETITKYAKAYKAAYPDFSFNLWIDPNAFAAYEFNSQLKSVALEHAKSEVINSLTIEELNVLKNKEQPDDG… |
| A0A6L2ZRZ3 | 96-271 | None |
| A0A2U8I5V6 | 93-273 | None |
| E0WUB6 | 93-235 | None |
| E0WTX7 | 13-231 | None |
| E0WTG4 | 1-198 | None |
| E0WSY9 | 2-181 | None |
| Q9EXR0 | 92-276 | None |
| A0A3N2QBB3 | 143-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.