DPCstruct | MC5367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 204 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318PKK1 | 1-203 | MRVPGWLGGSFLPVMLLWAPAFAAPAYHPGFACPRPDGSDVLATAVCADPVMAKAELDLEKVFYAHRAQEGAGAYPAIKAQAIAYAT… |
| A0A2S3VYX3 | 1-175 | MLCENSEATKHELMFDQTYYALRQLVGQAGWRALRNEAVTDEGTLKQCISVTGPQQPPSADPDCYMSHIDAITEKYRRRLSGAALEE… |
| A0A7X1VQV0 | 1-226 | None |
| A0A291PJG8 | 1-208 | None |
| A0A4Y6UIJ7 | 1-222 | None |
| A0A149VEQ1 | 1-172 | None |
| A0A6P1R5W9 | 3-205 | None |
| A0A7X7YDU3 | 2-225 | None |
| A0A2Z5ZLX0 | 230-442 | None |
| A0A6M8HQT4 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.