DPCstruct | MC53669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 175 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K6V586 | 756-928 | TPGAYLLKGDHHSITLNIKQKKSGSHTYSLYDPQVGNVDLTPTSSEGGDALYHLLDHYLQGKDKDGRTRAQQYGFEKMGNKYAFNAY… |
| A0A377VV28 | 301-482 | SLSIFFNNDVNNLLITTPAHTLIIQHFDSLYRVTDPNFGHAEFPSLSDAVHFLEAGIQLTPVLSKYYGLSGSNVRSHLFVYDISNIS… |
| A0A2U8I5X5 | 31-207 | None |
| A0A2U8I387 | 288-450 | None |
| E0WQT5 | 1-183 | None |
| C4K3P9 | 653-820 | None |
| A0A376U7Y4 | 238-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.