DPCstruct | MC53666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 423 ± 76 aa |
| Standard deviation of domain lengths | 76.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A240E876 | 1-335 | MEKNSSRDIIAYKLYSQADSVKGYIRPVAEFDGKNYILLNANNFCASEKVFVTSAYDEIDTKYKSLELFKITIFESQFKNPDLPIER… |
| A0A3M5XZQ8 | 2-463 | MSRLIVIKSHSHFQGNTGVVIPLIIEEDGNQPRAVYQDEFENGNKLFIADDYQVKIDESYREDELFVISSWNETDRDDWKTTTSKQR… |
| A0A3A8ZUD0 | 254-624 | None |
| A0A430F8F7 | 9-388 | None |
| A0A1W9SJI6 | 21-460 | None |
| A0A412DZV0 | 1-377 | None |
| U2WW86 | 1-389 | None |
| A0A7C6BLV9 | 11-431 | None |
| A0A086ZPM1 | 1-574 | None |
| A0A2A5AVB9 | 9-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.