DPCstruct | MC53662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 371 ± 23 aa |
| Standard deviation of domain lengths | 23.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2CRE3 | 117-499 | IFDESTNEELAYVAGGFLSCRVAAQYTEENGLAPEEATEMVAKGIRAFLCCEDKDLDVAFSGFPHDPLQVGLFYSTETWRSDHRKTV… |
| A0A7G2CL85 | 1-381 | MFSKSTSEELAHVAGGFLTCLVAAQYIKENDLNPDEATEMVAKGIRAFLCCEDNDLEMVFSGFPRDPLQLGLFSRTQTQRSSDKRTL… |
| A0A7G2CRF6 | 371-712 | None |
| A0A7G2CMS8 | 1-329 | None |
| A0A7G2CIC8 | 567-959 | None |
| A0A7G2CBW6 | 494-869 | None |
| A0A7G2C916 | 233-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.