DPCstruct | MC53660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 290 ± 49 aa |
| Standard deviation of domain lengths | 49.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | CL0266- PF04802- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3ABJ5 | 1-320 | MYNGGDEIFIGDTTPKRVKAYVLENNEWRDTGTGFCVGRLEKSDVQGDDTLHAFLVVNNEDAPEEILLKSRLEGNIEYQRQEETLIV… |
| A0A7G2CAB0 | 35-332 | SDSSAFSSRRQSRVGDNFTDRNALINLEVKVLTQSLGAENQWTECGDGLVEFSDMTIRVIAFKEEGKTEEKVLLEDTINSDTPFVGE… |
| A0A1S8W5J0 | 140-411 | None |
| A0A2H3EJH9 | 2-259 | None |
| L9JD97 | 5-273 | None |
| A0A7S1F9H8 | 1-273 | None |
| A0A1V2LMU7 | 2-297 | None |
| M2RUX8 | 7-281 | None |
| Q4UBH2 | 43-264 | None |
| S9XE74 | 350-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.