DPCstruct | MC53659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 185 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2C9K2 | 205-363 | LISRYHIDTQTITVDELNHQLNTHADLHTIFLSPFNFMQGRYFAELTKRTLDIYKEDAYSFAEFRLSMLGGSSQEWYELGHWFDRYG… |
| A0A0S7FLG1 | 54-252 | YPDEIVHVERGRGQTLREVFETMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNQVEGKYFAHIVKEVMY… |
| H8ZDC3 | 182-350 | None |
| A0A445B6A3 | 33-200 | None |
| A0A668AM50 | 242-419 | None |
| A0A086JZI8 | 140-316 | None |
| J9BIV8 | 11-152 | None |
| A0A7S1Q2P0 | 135-323 | None |
| A0A0G4HGK4 | 338-516 | None |
| A0A421JVF8 | 317-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.