DPCstruct | MC53652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 236 ± 64 aa |
| Standard deviation of domain lengths | 64.31 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 84.33 |
| Assigned Pfam label(s) | PF13559- PF07406- PF01255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177WLB9 | 4-153 | RTSFADIPKLYVPINRSDLPKPVYELVQAGLSRTASIQTSAKPLVDQIPDSIGLGKPHSTFEGLRFKDAAICTIAALEEAVCKISDH… |
| A0A367KT15 | 32-249 | DVCIQALADKTTTGKFDFRNLVVVGGTYVVLALASLLFSCSRVLSVRGSMQTIPKTHIPIRKNDLPKKVFTKLKNEFDETKRIRENT… |
| A0A1E3NSQ0 | 14-231 | None |
| A0A6V7HI18 | 206-424 | None |
| A0A0V1A5B4 | 6-209 | None |
| L5JX11 | 111-360 | None |
| A0A6I9JI86 | 1-201 | None |
| A0A1D2NKV9 | 581-800 | None |
| S7QN03 | 9-206 | None |
| G4TA76 | 3-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.