DPCstruct | MC53651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 776 |
|---|---|
| Mean domain length (aa) | 235 ± 45 aa |
| Standard deviation of domain lengths | 45.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF05460- CL0111- PF00161- PF02330- PF14839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367KPR1 | 18-248 | VSENDYVKIRIWFCHLIQKLAKRLQLRQQVVATAFVYFKRFYINNSLRETDPVLVLVTCVYLATKIEECPIHIKMVTQEAKNVFQSE… |
| A0A6J1R8R0 | 1-176 | MSVVRSKLQLVGTAAMFIAAKYEEIYPPDVGEFVYITDDTYSKNQVIKMENLILRVLSFDLTVPTHYTFLLEYCISNNLSDKIKFLA… |
| A0A1Y1VDV4 | 27-275 | None |
| K9FV19 | 268-511 | None |
| A0A2R6QDG2 | 16-277 | None |
| A0A2T7EH20 | 47-297 | None |
| L8YFP5 | 601-802 | None |
| A0A0D2N5B0 | 103-361 | None |
| G1SJR5 | 103-345 | None |
| A0A4U0VXV9 | 708-972 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.