DPCstruct | MC53650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 119 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P8AYW5 | 519-615 | PVTVLGPLRLVHEPPNGETAADGVYTLCGHLHPGIRLEGKGRQRMTVPCFLFGEHTGVLPAFGGFTGLHVIRPCSTDRIYVPVAESA… |
| A0A7C5RXU4 | 92-213 | IIVKGNHDGWIEKMVPKNIKVRKYITIDNYLFTHGHRKVKTKKNIVIGHNHPFIKFIDDFGNKYYEPVWLLGKIKNQIIIIMPSFNE… |
| Q9HRU2 | 3-120 | None |
| A0A257JEN0 | 83-192 | None |
| A0A7Y2H7B5 | 5-78 | None |
| A0A238UNZ8 | 183-297 | None |
| Q0C4K5 | 330-441 | None |
| A0A1I5ZJM8 | 123-206 | None |
| A0A838NQ61 | 19-127 | None |
| A0A662UY31 | 58-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.