DPCstruct | MC53648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 339 ± 96 aa |
| Standard deviation of domain lengths | 95.88 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | PF01131- CL0662- PF13368- CL0413- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5MMX8 | 161-443 | EVGQMFVNMTKTSREAKVESVSKKEKAKQRPLALNTVEMLRVASSSLGMGPQHTMQIAERLYTQGYISYPRTETNHYHDNFDLKGTL… |
| A0A7C4D3L9 | 586-892 | YAILIDFQVKDETEHKPLPTDTDTMLQELSKIMGLSATKIMALAETLYGDGYISYPRTETNMWLSVDHKSILNMLSSTPLGRYINVF… |
| A0A7R9XTJ9 | 43-416 | None |
| A0A7V4PCN2 | 3-244 | None |
| A0A811MMM2 | 151-516 | None |
| A0A1Q9CKT6 | 2-278 | None |
| A0A0D8XUE2 | 486-799 | None |
| M1UQ11 | 9-754 | None |
| A0A812JUV4 | 582-1052 | None |
| A0A1Y5EEG9 | 181-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.