DPCstruct | MC53647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4D3R0 | 29-128 | MVEFQKSPHRMFTCYSGTHSFFMDAYGNIYPCIMLSKRIGNILYSSFDELWFSKRAYEVRRFIKDKKCYCWTPCETCPSLSRDPKVL… |
| A0A7U9RG87 | 39-159 | ELLKSSSPKKWFRAYFNHGLINYIYGNKRLLPCDMSQNAFFIDPFCDVIPCNGMAQKAVMGNLRKQSWDELWNSKQAEEVRACTRKC… |
| A0A7C0UIP5 | 4-95 | None |
| A0A7V0WE23 | 45-159 | None |
| A0A7J0B8P6 | 3-111 | None |
| A0A7J4FJF1 | 37-155 | None |
| A0A7J3XKC9 | 165-277 | None |
| A0A7J3DM09 | 43-135 | None |
| A0A1V6JDH0 | 195-328 | None |
| A0A2V7CG42 | 4-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.