DPCstruct | MC53635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 222 ± 17 aa |
| Standard deviation of domain lengths | 16.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18211 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0YG78 | 301-519 | LTEAVAHCITRHFELPLCNIIISSGGRFYILVPNHPEAATWLDTLQRELDKWSVISFSGEIRINLAHIFFRGGDFEKFGVILEEVNA… |
| A0A3S1C127 | 216-452 | VTEEVVQQLLDQLQLPRTNIIYAGGGNLYILASGIEKNKIVIQQVRQQFNEWLLKEFQGKVFLALDCLNFPITEIATDEFANHWSNA… |
| A0A5C7SVY9 | 346-592 | None |
| A0A1V5G1G5 | 23-251 | None |
| A0A091C641 | 263-462 | None |
| A0A7R9N6F2 | 1-193 | None |
| A0A6H1WUP4 | 73-306 | None |
| A0A2V3JCY5 | 185-420 | None |
| A0A7C2IS02 | 287-491 | None |
| A0A1W9TNG8 | 673-889 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.