DPCstruct | MC53631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 170 ± 37 aa |
| Standard deviation of domain lengths | 36.83 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0177- CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0SD43 | 2-168 | TERQALTMVELPLALPVIMAGIRTAAVWVIGTATLSTPIGQTSLGNYIFAGLQTQNWVLVVFGCVAAAVLALVVDQLLALIENGLRA… |
| S7IMY0 | 1-239 | TPEELLEQFILHQATKQQIFIKLRLPHALPHIFSGLKIAMGSAGFAAIAGEWLASQSGLGILILESRRNYDMEMTFAGLFALTLLTF… |
| A0A7W0ZL17 | 2-169 | None |
| A0A1G8CZ20 | 2-152 | None |
| H1B543 | 2-153 | None |
| R6PGS7 | 42-282 | None |
| A0A1G9Z6E9 | 2-140 | None |
| A0A2S3U9Z4 | 150-307 | None |
| A0A380FDW1 | 2-129 | None |
| A0A496KT34 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.