DPCstruct | MC5362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H5VCH8 | 2-106 | IHCQRCIITANLSDAEIAKTKQEMGEEAFYVMADDANYENYDVMRYAEANHIPYVVVDEDYNYLVTPKQRVKMDNKWGYWLYAQGKS… |
| A0A444W4D0 | 48-148 | SLELQQPTVVVVEFDSLEIEAYKSDVGEEDFYTGADDLMYYDAMMRTKMQSLNIPVVNTEKDVVYINKDTDTITIVKDTTFSLYSYF… |
| A0A6L3ZF33 | 363-477 | None |
| A0A2V3A4P8 | 13-142 | None |
| A0A291QRL2 | 6-106 | None |
| A0A1H7Y7M0 | 15-130 | None |
| A0A1V6I8G9 | 110-244 | None |
| A0A7X9S0T9 | 85-207 | None |
| A0A4V1MK07 | 4-110 | None |
| A0A2G5L818 | 170-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.