DPCstruct | MC53615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8DWF8 | 1-89 | MEKRSHGLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIETLLMRLPRMFKQEFTGVGATLEKRWKLCAFEGIK… |
| A0A2G8KWB5 | 542-631 | SSEVQGRTTEPSVEVKRSEGALLSFICIFLHAHPFGASIDYLYSYLSRLHPNIVLSDIDGLLHGYPNCFVQELSGVGASLERRWKFV… |
| A0A3B3D296 | 299-400 | None |
| A0A4Y2I0L7 | 221-312 | None |
| T1J4U0 | 1045-1148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.