DPCstruct | MC53613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 295 ± 40 aa |
| Standard deviation of domain lengths | 40.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CMZ3 | 4-334 | TQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRK… |
| A0A6P4N1M1 | 2-239 | NFRLELFFKDDSKHGVSVVDLYELVQHAGNILPRLYLLCTVGSIYIKSKEAPAKEVLKDLVEMCRGVQHPIRGLFLRSYLAQISRDK… |
| A0A0R3T432 | 6-390 | None |
| U6LNH0 | 3-221 | None |
| V6LYG7 | 16-352 | None |
| A0A821HN40 | 6-239 | None |
| A0A1E7EP30 | 51-336 | None |
| A0A261XUV8 | 288-546 | None |
| A0A1Y3ET03 | 3-261 | None |
| A0A3P7ZSR4 | 22-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.